PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100278330011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 510aa    MW: 58366.1 Da    PI: 7.0638
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100278330011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.4e-202379157
                                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                      Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                  r kR+  t+ qle Le+ ++++ yps+++r+eL++klgLt+rq ++WF+ rR k+kk
  Ote100278330011|100278330011 23 RPKRQMKTPFQLEMLEKTYAMETYPSEATRAELSEKLGLTDRQLQMWFCHRRLKDKK 79
                                  579****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-191180IPR009057Homeodomain-like
SuperFamilySSF466892.44E-181280IPR009057Homeodomain-like
PROSITE profilePS5007117.1672080IPR001356Homeobox domain
SMARTSM003891.4E-182284IPR001356Homeobox domain
PfamPF000462.1E-172379IPR001356Homeobox domain
CDDcd000869.73E-152381No hitNo description
PROSITE profilePS5082712.325473510IPR018501DDT domain
PfamPF027917.3E-10474508IPR018501DDT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MEAGTEGEIN RNMNQSPPEG SKRPKRQMKT PFQLEMLEKT YAMETYPSEA TRAELSEKLG  60
LTDRQLQMWF CHRRLKDKKE SVGVAAMKPR TPGPVGRKGF TESPREELMA AEPGSGHVSA  120
SGSASGSGSG SSQYDTGDAG MVPSRYYESP RTIMQRRVVE CVEAQLGEPL REDGPILGVE  180
FDELPPGAFG APIVPVEQED RYRHSYDSKL YGQYDVKHSK TASSAPHDAL ETKIRTDAYG  240
AQPYLYDSPV GGLPPKGLSL MHENGLLSRE HVVEGQPSRI ELYSQPGRQM QISLSPRNTD  300
FFTQNDANVY VERKRKSDDT RIVREGHTHD KKVRKELEKL DVLKRKRQEE KFQREEKREM  360
ERREKFMQKE LLRAEKRKQK EERRLEKEAA RQRAAMERAT ARRIAKESLE LIEDERLELM  420
ELAASSKGLP SILSLDYDTL QNLDSFREAL CEFPPRTVKL RKPFAIQPWM DSEENVGNLL  480
MVWKFCLTFA DVLGLWPFTI DEFIQAFHDC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096357.10.0PREDICTED: uncharacterized protein LOC105175572 isoform X1
RefseqXP_011096358.10.0PREDICTED: uncharacterized protein LOC105175572 isoform X2
SwissprotF4HY561e-126RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A022QL900.0A0A022QL90_ERYGU; Uncharacterized protein
STRINGSolyc02g077660.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21422352